PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi07g10230.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family G2-like
Protein Properties Length: 352aa    MW: 39443.6 Da    PI: 7.1433
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi07g10230.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.92e-32219274156
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                      k+r++W+peLH+rFv+a++qLGG+++AtPk+i+e+m+v gLt+++vkSHLQkYRl+
  Vradi07g10230.1 219 KQRRCWSPELHRRFVDALQQLGGPQVATPKQIREVMQVVGLTNDEVKSHLQKYRLH 274
                      79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.229216276IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-28217277IPR009057Homeodomain-like
SuperFamilySSF466891.04E-17217277IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-26219274IPR006447Myb domain, plants
PfamPF002497.2E-8221272IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MELSLDLSLA FVPGRTVRQI LGQVAQNEDG SQRMATLEDF LQKLEDEKRK IESFKRELPL  60
CMLLVNDAIT KLKEEINGGV RMQEEPVVLK TNSEGSETLN MGKERSNMKN WMNSVRLWNV  120
ESKPRTEEDD RCVPDNPNQP QNETNKSRGA ALNGNNCVLK TVMSEEKGVS QVPSVGLMRP  180
VFELNDRKAE SSNEHGSSLI ATRSLEIKGQ AQPQQNPRKQ RRCWSPELHR RFVDALQQLG  240
GPQVATPKQI REVMQVVGLT NDEVKSHLQK YRLHFRRPQV CSVEVANGGL CLMVKDNNKS  300
KGNLLSQSGS PQGPLFLGGS GRNSMDTEED EQSDCHNWKG ALHHQPEAEL L*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150341e-158AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014507245.10.0PREDICTED: uncharacterized protein LOC106766958 isoform X1
TrEMBLA0A0L9TG550.0A0A0L9TG55_PHAAN; Uncharacterized protein
TrEMBLA0A0S3R4E70.0A0A0S3R4E7_PHAAN; Uncharacterized protein
STRINGGLYMA17G20520.21e-156(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.16e-57G2-like family protein